PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C017491P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 352aa    MW: 39800.2 Da    PI: 7.0292
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C017491P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.46e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ +++++G+g +W + ++++g++R++k+c++rw++yl
   MELO3C017491P1 14 KGPWSPEEDARLKAYIEEHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding39.71.1e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++ ++    G++ W+ Ia+ ++ gRt++++k++w++
   MELO3C017491P1  69 GGFSEEEDNIICNLYISIGSR-WSVIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.281966IPR017930Myb domain
SuperFamilySSF466891.13E-2611109IPR009057Homeodomain-like
SMARTSM007177.6E-131364IPR001005SANT/Myb domain
PfamPF002499.4E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-241569IPR009057Homeodomain-like
CDDcd001674.16E-91662No hitNo description
PROSITE profilePS5129416.36167117IPR017930Myb domain
SMARTSM007171.6E-1167115IPR001005SANT/Myb domain
PfamPF002493.4E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2370117IPR009057Homeodomain-like
CDDcd001675.29E-871111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis
GO:2000067Biological Processregulation of root morphogenesis
GO:0048226Cellular ComponentCasparian strip
GO:0000975Molecular Functionregulatory region DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDARLKAYIE EHGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC NLYISIGSRW SVIAAQLPGR TDNDIKNYWN TRLKKKLLGK  120
RKQSHSNNGI NSSSSSSNND DPKEVLSNSA LERLQLHMQL QGFQNPFSFY SHPQLWPKLH  180
PMQEKIVQTL QSLNNNTQNP HFLNPNDLQS TTTNTQLLQS QPPKAATDFF IHQQTNTNSI  240
SLPSKIPENS DHHQVESSSG HHQVSNFMQV VDGFLEDHNK GEGFMAQSDE QVAEFDWFKE  300
VGGCSKNSLI WWGQNNEHDM RSAASSSNSW DSSSVLQSEL MFQDFELGYN L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-231411727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818130.0LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453635.10.0PREDICTED: transcription factor RAX2-like
SwissprotQ9FKL21e-101MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A0A0LX580.0A0A0A0LX58_CUCSA; Uncharacterized protein
STRINGPOPTR_0018s10390.11e-133(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.12e-90myb domain protein 36